CSTF2T Antikörper (C-Term)
-
- Target Alle CSTF2T Antikörper anzeigen
- CSTF2T (Cleavage Stimulation Factor, 3' Pre-RNA, Subunit 2, 64kDa, tau Variant (CSTF2T))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CSTF2T Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- CSTF2 T antibody was raised against the C terminal of CSTF2
- Aufreinigung
- Affinity purified
- Immunogen
- CSTF2 T antibody was raised using the C terminal of CSTF2 corresponding to a region with amino acids AGIQGGGMQGAGIQGVSIQGGGIQGGGIQGASKQGGSQPSSFSPGQSQVT
- Top Product
- Discover our top product CSTF2T Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
CSTF2T Blocking Peptide, catalog no. 33R-1203, is also available for use as a blocking control in assays to test for specificity of this CSTF2T antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CSTF0 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CSTF2T (Cleavage Stimulation Factor, 3' Pre-RNA, Subunit 2, 64kDa, tau Variant (CSTF2T))
- Andere Bezeichnung
- CSTF2T (CSTF2T Produkte)
- Synonyme
- 64kDa antikoerper, C77975 antikoerper, tCstF-64 antikoerper, tauCstF-64 antikoerper, CstF-64T antikoerper, cleavage stimulation factor, 3' pre-RNA subunit 2, tau antikoerper, cleavage stimulation factor subunit 2 tau variant antikoerper, cleavage stimulation factor subunit 2, tau variant antikoerper, Cstf2t antikoerper, CSTF2T antikoerper
- Hintergrund
- CSTF2T may play a significant role in AAUAAA-independent mRNA polyadenylation in germ cells. It is directly involved in the binding to pre-mRNAs.
- Molekulargewicht
- 64 kDa (MW of target protein)
-