CSTF2T Antikörper (C-Term)

Produktnummer ABIN633569

Der Kaninchen Polyklonal anti-CSTF2T Antikörper wird verwendet zum Nachweis von CSTF2T in Proben von Human. Er wurde validiert für WB.

Kurzübersicht für CSTF2T Antikörper (C-Term) (ABIN633569)

Target: CSTF2T (Cleavage Stimulation Factor, 3' Pre-RNA, Subunit 2, 64kDa, tau Variant (CSTF2T))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CSTF2T Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-CSTF2T Antikörper

Bindungsspezifität: C-Term

Spezifität: CSTF2 T antibody was raised against the C terminal of CSTF2

Aufreinigung: Affinity purified

Immunogen: CSTF2 T antibody was raised using the C terminal of CSTF2 corresponding to a region with amino acids AGIQGGGMQGAGIQGVSIQGGGIQGGGIQGASKQGGSQPSSFSPGQSQVT

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CSTF2T Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this CSTF2T antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CSTF0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CSTF2T

Target: CSTF2T (Cleavage Stimulation Factor, 3' Pre-RNA, Subunit 2, 64kDa, tau Variant (CSTF2T))

Andere Bezeichnung: CSTF2T

Hintergrund: CSTF2T may play a significant role in AAUAAA-independent mRNA polyadenylation in germ cells. It is directly involved in the binding to pre-mRNAs.

Molekulargewicht: 64 kDa (MW of target protein)