APOBEC3B Antikörper (N-Term)

Produktnummer ABIN633499

Produktdetails anti-APOBEC3B Antikörper

Target: APOBEC3B (Apolipoprotein B mRNA Editing Enzyme, Catalytic Polypeptide-Like 3B (APOBEC3B))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser APOBEC3B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ApoBEC3 B antibody was raised against the N terminal of APOBEC3

Aufreinigung: Affinity purified

Immunogen: ApoBEC3 B antibody was raised using the N terminal of APOBEC3 corresponding to a region with amino acids NQLPAYKCFQITWFVSWTPCPDCVAKLAEFLSEHPNVTLTISAARLYYYW

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ApoBEC3B Blocking Peptide, catalog no. 33R-6841, is also available for use as a blocking control in assays to test for specificity of this ApoBEC3B antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of APOBEC0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu APOBEC3B

Target: APOBEC3B (Apolipoprotein B mRNA Editing Enzyme, Catalytic Polypeptide-Like 3B (APOBEC3B))

Andere Bezeichnung: ApoBEC3B (APOBEC3B Produkte)

Synonyme: A3B antikoerper, APOBEC1L antikoerper, ARCD3 antikoerper, ARP4 antikoerper, DJ742C19.2 antikoerper, PHRBNL antikoerper, bK150C2.2 antikoerper, APOBEC3B antikoerper, Apobec3 antikoerper, Apobec3f antikoerper, APOBEC3F antikoerper, APOBEC3Z2 antikoerper, APOBEC3Z3 antikoerper, apolipoprotein B mRNA editing enzyme catalytic subunit 3B antikoerper, APOBEC3B antikoerper, Apobec3b antikoerper

Hintergrund: APOBEC3B is a member of the cytidine deaminase family. It is thought that these proteins may be RNA editing enzymes and have roles in growth or cell cycle control.

Molekulargewicht: 46 kDa (MW of target protein)