IGF2BP2 Antikörper (Middle Region)
-
- Target Alle IGF2BP2 Antikörper anzeigen
- IGF2BP2 (Insulin-Like Growth Factor 2 mRNA Binding Protein 2 (IGF2BP2))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser IGF2BP2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- IGF2 BP2 antibody was raised against the middle region of IGF2 P2
- Aufreinigung
- Affinity purified
- Immunogen
- IGF2 BP2 antibody was raised using the middle region of IGF2 P2 corresponding to a region with amino acids QANLIPGLNLSALGIFSTGLSVLSPPAGPRGAPPAAPYHPFTTHSGYFSS
- Top Product
- Discover our top product IGF2BP2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
IGF2BP2 Blocking Peptide, catalog no. 33R-7470, is also available for use as a blocking control in assays to test for specificity of this IGF2BP2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IGF0 P2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- IGF2BP2 (Insulin-Like Growth Factor 2 mRNA Binding Protein 2 (IGF2BP2))
- Andere Bezeichnung
- IGF2BP2 (IGF2BP2 Produkte)
- Synonyme
- IMP-2 antikoerper, IMP2 antikoerper, VICKZ2 antikoerper, p62 antikoerper, C330012H03Rik antikoerper, Imp2 antikoerper, Neilsen antikoerper, RGD1305614 antikoerper, insulin like growth factor 2 mRNA binding protein 2 antikoerper, insulin-like growth factor 2 mRNA binding protein 2 antikoerper, IGF2BP2 antikoerper, Igf2bp2 antikoerper
- Hintergrund
- IGF2BP2 binds to the 5'-UTR of the insulin-like growth factor 2 (IGF2) mRNAs. Binding is isoform-specific. IGF2BP2 may regulate translation of target mRNAs.
- Molekulargewicht
- 66 kDa (MW of target protein)
-