CPNE1 Antikörper (Middle Region)
-
- Target Alle CPNE1 Antikörper anzeigen
- CPNE1 (Copine I (CPNE1))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CPNE1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- Copine I antibody was raised against the middle region of CPNE1
- Aufreinigung
- Affinity purified
- Immunogen
- Copine I antibody was raised using the middle region of CPNE1 corresponding to a region with amino acids VQCSDYDSDGSHDLIGTFHTSLAQLQAVPAEFECIHPEKQQKKKSYKNSG
- Top Product
- Discover our top product CPNE1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Copine I Blocking Peptide, catalog no. 33R-9744, is also available for use as a blocking control in assays to test for specificity of this Copine I antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CPNE1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CPNE1 (Copine I (CPNE1))
- Andere Bezeichnung
- Copine I (CPNE1 Produkte)
- Synonyme
- CPNE1 antikoerper, MGC108079 antikoerper, COPN1 antikoerper, CPN1 antikoerper, 1810028N16Rik antikoerper, mKIAA4108 antikoerper, cpne3 antikoerper, cpne3l antikoerper, wu:fb69d07 antikoerper, wu:fc45a04 antikoerper, zgc:55873 antikoerper, copine I antikoerper, copine 1 antikoerper, RNA-binding protein 12 antikoerper, copine-1 antikoerper, copine I L homeolog antikoerper, CPNE1 antikoerper, cpne1 antikoerper, CPNE1b antikoerper, LOC100032499 antikoerper, LOC100484845 antikoerper, EDI_033120 antikoerper, LOC100281056 antikoerper, cpne1.L antikoerper, Cpne1 antikoerper
- Hintergrund
- Calcium-dependent membrane-binding proteins may regulate molecular events at the interface of the cell membrane and cytoplasm. CPNE1 is a calcium-dependent protein that also contains two N-terminal type II C2 domains and an integrin A domain-like sequence in the C-terminus. However, the protein does not contain a predicted signal sequence or transmembrane domains. This protein has a broad tissue distribution and it may function in membrane trafficking. Calcium-dependent membrane-binding proteins may regulate molecular events at the interface of the cell membrane and cytoplasm.
- Molekulargewicht
- 59 kDa (MW of target protein)
-