PSMA1 Antikörper
-
- Target Alle PSMA1 Antikörper anzeigen
- PSMA1 (Proteasome Subunit alpha Type 1 (PSMA1))
-
Reaktivität
- Human, Maus, Ratte, Hund, Zebrafisch (Danio rerio)
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PSMA1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- PSMA1 antibody was raised using a synthetic peptide corresponding to a region with amino acids TYLERHMSEFMECNLNELVKHGLRALRETLPAEQDLTTKNVSIGIVGKDL
- Top Product
- Discover our top product PSMA1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PSMA1 Blocking Peptide, catalog no. 33R-9392, is also available for use as a blocking control in assays to test for specificity of this PSMA1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PSMA1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PSMA1 (Proteasome Subunit alpha Type 1 (PSMA1))
- Andere Bezeichnung
- PSMA1 (PSMA1 Produkte)
- Synonyme
- PSMA1 antikoerper, pros30 antikoerper, DDBDRAFT_0204226 antikoerper, DDBDRAFT_0214956 antikoerper, DDB_0204226 antikoerper, DDB_0214956 antikoerper, C2 antikoerper, HC2 antikoerper, Pros-30 antikoerper, alpha-type antikoerper, NU antikoerper, PROS30 antikoerper, CC2 antikoerper, zgc:92726 antikoerper, 143314_at antikoerper, Alpha-6 antikoerper, CG4904 antikoerper, Dmel\CG4904 antikoerper, PROS-35 antikoerper, PROS-Dm35 antikoerper, Pros-35 antikoerper, Pros-Dm35 antikoerper, Prosalpha6 antikoerper, alpha6 antikoerper, alpha_dm antikoerper, anon-SAGE:Wang-116 antikoerper, pros 35 antikoerper, pros35 antikoerper, proteasome subunit alpha 1 antikoerper, proteasome subunit alpha type 1 antikoerper, 20S proteasome subunit C2 antikoerper, proteasome (prosome, macropain) subunit, alpha type 1 antikoerper, proteasome subunit alpha 1 L homeolog antikoerper, Proteasome alpha6 subunit antikoerper, PSMA1 antikoerper, psma1 antikoerper, CNB05540 antikoerper, psmA1 antikoerper, Psma1 antikoerper, psma1.L antikoerper, Prosalpha6 antikoerper
- Hintergrund
- The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits, 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. PSMA1 is a member of the peptidase T1A family which is a 20S core alpha subunit.
- Molekulargewicht
- 29 kDa (MW of target protein)
- Pathways
- Mitotic G1-G1/S Phases, DNA Replication, Synthesis of DNA
-