BOLL Antikörper

Produktnummer ABIN633322

Produktdetails anti-BOLL Antikörper

Target: BOLL (Bol, Boule-Like (BOLL))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser BOLL Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: BOLL antibody was raised using a synthetic peptide corresponding to a region with amino acids GGIDFKTNESDLRKFFSQYGSVKEVKIVNDRAGVSKGYGFVTFETQEDAQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

BOLL Blocking Peptide, catalog no. 33R-3288, is also available for use as a blocking control in assays to test for specificity of this BOLL antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BOLL antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu BOLL

Target: BOLL (Bol, Boule-Like (BOLL))

Andere Bezeichnung: BOLL (BOLL Produkte)

Synonyme: BOULE antikoerper, 4930554P13Rik antikoerper, 4930597B14Rik antikoerper, RGD1559527 antikoerper, boule homolog, RNA binding protein antikoerper, bol, boule-like (Drosophila) antikoerper, BOLL antikoerper, Boll antikoerper

Hintergrund: This gene belongs to the DAZ gene family required for germ cell development. BOLL is an RNA-binding protein which is more similar to Drosophila Boule than to human proteins encoded by genes DAZ (deleted in azoospermia) or DAZL (deleted in azoospermia-like). Loss of this gene function results in the absence of sperm in semen (azoospermia). Histological studies demonstrated that the primary defect is at the meiotic G2/M transition.

Molekulargewicht: 31 kDa (MW of target protein)