APOBEC1 Antikörper (N-Term)

Produktnummer ABIN633309

Produktdetails anti-APOBEC1 Antikörper

Target: APOBEC1 (Apolipoprotein B mRNA Editing Enzyme, Catalytic Polypeptide 1 (APOBEC1))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser APOBEC1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ApoBEC1 antibody was raised against the N terminal of APOBEC1

Aufreinigung: Affinity purified

Immunogen: ApoBEC1 antibody was raised using the N terminal of APOBEC1 corresponding to a region with amino acids TSEKGPSTGDPTLRRRIEPWEFDVFYDPRELRKEACLLYEIKWGMSRKIW

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ApoBEC1 Blocking Peptide, catalog no. 33R-9281, is also available for use as a blocking control in assays to test for specificity of this ApoBEC1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of APOBEC1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu APOBEC1

Target: APOBEC1 (Apolipoprotein B mRNA Editing Enzyme, Catalytic Polypeptide 1 (APOBEC1))

Andere Bezeichnung: ApoBEC1 (APOBEC1 Produkte)

Synonyme: APOBEC-1 antikoerper, BEDP antikoerper, CDAR1 antikoerper, HEPR antikoerper, Cdar1 antikoerper, REPR antikoerper, APOBEC1 antikoerper, apolipoprotein B mRNA editing enzyme catalytic subunit 1 antikoerper, apolipoprotein B mRNA editing enzyme, catalytic polypeptide 1 antikoerper, APOBEC1 antikoerper, Apobec1 antikoerper

Hintergrund: APOBEC1 is a member of the cytidine deaminase enzyme family. The protein forms a multiple-protein editing holoenzyme with APOBEC1 complementation factor (ACF) and APOBEC1 stimulating protein (ASP). This holoenzyme is involved in the editing of C-to-U nucleotide bases in apolipoprotein B and neurofibromatosis-1 mRNAs.

Molekulargewicht: 28 kDa (MW of target protein)