Pre-mRNA Branch Site Protein p14 (SF3B14) (Middle Region) Antikörper
-
- Target Alle Pre-mRNA Branch Site Protein p14 (SF3B14) Antikörper anzeigen
- Pre-mRNA Branch Site Protein p14 (SF3B14)
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- SF3 B14 antibody was raised against the middle region of SF3 14
- Aufreinigung
- Affinity purified
- Immunogen
- SF3 B14 antibody was raised using the middle region of SF3 14 corresponding to a region with amino acids HLSGFNVCNRYLVVLYYNANRAFQKMDTKKKEEQLKLLKEKYGINTDPPK
- Top Product
- Discover our top product SF3B14 Primärantikörper
-
-
- Applikationshinweise
-
WB: 2 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SF3B14 Blocking Peptide, catalog no. 33R-3788, is also available for use as a blocking control in assays to test for specificity of this SF3B14 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SF0 14 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Pre-mRNA Branch Site Protein p14 (SF3B14)
- Andere Bezeichnung
- SF3B14 (SF3B14 Produkte)
- Synonyme
- 6030419K15Rik antikoerper, AV001342 antikoerper, Sf3b14 antikoerper, zgc:86708 antikoerper, HSPC175 antikoerper, Ht006 antikoerper, P14 antikoerper, SAP14 antikoerper, SF3B14a antikoerper, splicing factor 3B, subunit 6 antikoerper, splicing factor 3b, subunit 6 antikoerper, splicing factor 3b subunit 6 S homeolog antikoerper, splicing factor 3b subunit 6 antikoerper, Sf3b6 antikoerper, sf3b6 antikoerper, sf3b6.S antikoerper, SF3B6 antikoerper
- Hintergrund
- SF3B14 is a 14 kDa protein subunit of the splicing factor 3b complex. Splicing factor 3b associates with both the U2 and U11/U12 small nuclear ribonucleoprotein complexes (U2 snRNP) of spliceosomes. This 14 kDa protein interacts directly with subunit 1 of the splicing factor 3b complex. SF3B14 also interacts directly with the adenosine that carries out the first transesterification step of splicing at the pre-mRNA branch site.
- Molekulargewicht
- 14 kDa (MW of target protein)
-