SHPRH Antikörper (N-Term)

Produktnummer ABIN633252

Produktdetails anti-SHPRH Antikörper

Target: SHPRH (SNF2 Histone Linker PHD RING Helicase, E3 Ubiquitin Protein Ligase (SHPRH))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SHPRH Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: SHPRH antibody was raised against the N terminal of SHPRH

Aufreinigung: Affinity purified

Immunogen: SHPRH antibody was raised using the N terminal of SHPRH corresponding to a region with amino acids SIIPDVLEEDEDDPESEPEGQDIDELYHFVKQTHQQETQSIQVDVQHPAL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SHPRH Blocking Peptide, catalog no. 33R-8531, is also available for use as a blocking control in assays to test for specificity of this SHPRH antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SHPRH antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SHPRH

Target: SHPRH (SNF2 Histone Linker PHD RING Helicase, E3 Ubiquitin Protein Ligase (SHPRH))

Andere Bezeichnung: SHPRH (SHPRH Produkte)

Synonyme: bA545I5.2 antikoerper, 2610103K11Rik antikoerper, AA450458 antikoerper, AU024614 antikoerper, BC006883 antikoerper, D230017O13Rik antikoerper, E130018M05 antikoerper, SNF2 histone linker PHD RING helicase antikoerper, SHPRH antikoerper, Shprh antikoerper

Hintergrund: SHPRH is a ubiquitously expressed protein that contains motifs characteristics of several DNA repair proteins, transcription factors, and helicases.

Molekulargewicht: 190 kDa (MW of target protein)