XPOT Antikörper
-
- Target Alle XPOT Antikörper anzeigen
- XPOT (Exportin, tRNA (Nuclear Export Receptor For TRNAs) (XPOT))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser XPOT Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- XPOT antibody was raised using a synthetic peptide corresponding to a region with amino acids TVLSDQQKANVEAIMLAVMKKLTYDEEYNFENEGEDEAMFVEYRKQLKLL
- Top Product
- Discover our top product XPOT Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
XPOT Blocking Peptide, catalog no. 33R-9364, is also available for use as a blocking control in assays to test for specificity of this XPOT antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of XPOT antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- XPOT (Exportin, tRNA (Nuclear Export Receptor For TRNAs) (XPOT))
- Andere Bezeichnung
- XPOT (XPOT Produkte)
- Synonyme
- 110.t00019 antikoerper, XPO3 antikoerper, Exportin-T antikoerper, si:ch211-286m4.4 antikoerper, exportin-T antikoerper, 1110004L07Rik antikoerper, 3110065H13Rik antikoerper, AI452076 antikoerper, C79645 antikoerper, EXPORTIN-T antikoerper, exportin T antikoerper, exportin for tRNA antikoerper, exportin, tRNA (nuclear export receptor for tRNAs) antikoerper, EHI_029040 antikoerper, XPOT antikoerper, Xpot antikoerper, xpot antikoerper
- Hintergrund
- XPOT belonging to the RAN-GTPase exportin family that mediates export of tRNA from the nucleus to the cytoplasm. Translocation of tRNA to the cytoplasm occurs once exportin has bound both tRNA and GTP-bound RAN.
- Molekulargewicht
- 110 kDa (MW of target protein)
-