HNRNPA2B1 Antikörper (N-Term)

Produktnummer ABIN633233

Produktdetails anti-HNRNPA2B1 Antikörper

Target: HNRNPA2B1 (Heterogeneous Nuclear Ribonucleoprotein A2/B1 (HNRNPA2B1))

Bindungsspezifität: N-Term

Reaktivität: Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HNRNPA2B1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: HNRNPA2 B1 antibody was raised against the N terminal of HNRNPA2 1

Aufreinigung: Affinity purified

Immunogen: HNRNPA2 B1 antibody was raised using the N terminal of HNRNPA2 1 corresponding to a region with amino acids MEKTLETVPLERKKREKEQFRKLFIGGLSFETTEESLRNYYEQWGKLTDC

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

HNRNPA2B1 Blocking Peptide, catalog no. 33R-5932, is also available for use as a blocking control in assays to test for specificity of this HNRNPA2B1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HNRNPA0 1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu HNRNPA2B1

Target: HNRNPA2B1 (Heterogeneous Nuclear Ribonucleoprotein A2/B1 (HNRNPA2B1))

Andere Bezeichnung: HNRNPA2B1 (HNRNPA2B1 Produkte)

Synonyme: HNRNPA2 antikoerper, HNRNPB1 antikoerper, HNRPA2 antikoerper, HNRPA2B1 antikoerper, HNRPB1 antikoerper, RNPA2 antikoerper, SNRPB1 antikoerper, hnrpa2b1 antikoerper, MGC53135 antikoerper, HNRNPA2B1 antikoerper, hnrnpa2 antikoerper, hnrnpb1 antikoerper, hnrpa2 antikoerper, hnrpb1 antikoerper, rnpa2 antikoerper, snrpb1 antikoerper, 9130414A06Rik antikoerper, Hnrpa2 antikoerper, Hnrpa2b1 antikoerper, hnrnp-A antikoerper, hnRNP antikoerper, heterogeneous nuclear ribonucleoprotein A2/B1 antikoerper, heterogeneous nuclear ribonucleoprotein A2/B1 S homeolog antikoerper, heterogeneous nuclear ribonucleoproteins A2/B1 antikoerper, HNRNPA2B1 antikoerper, hnrnpa2b1.S antikoerper, hnrnpa2b1 antikoerper, Hnrnpa2b1 antikoerper, LOC100353281 antikoerper

Hintergrund: HNRNPA2B1 belongs to the A/B subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm.

Molekulargewicht: 37 kDa (MW of target protein)