SF3B3 Antikörper (Middle Region)
-
- Target Alle SF3B3 Antikörper anzeigen
- SF3B3 (Splicing Factor 3b, Subunit 3, 130kDa (SF3B3))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SF3B3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- SF3 B3 antibody was raised against the middle region of SF3 3
- Aufreinigung
- Affinity purified
- Immunogen
- SF3 B3 antibody was raised using the middle region of SF3 3 corresponding to a region with amino acids EHPPLCGRDHLSFRSYYFPVKNVIDGDLCEQFNSMEPNKQKNVSEELDRT
- Top Product
- Discover our top product SF3B3 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SF3B3 Blocking Peptide, catalog no. 33R-2457, is also available for use as a blocking control in assays to test for specificity of this SF3B3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SF0 3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SF3B3 (Splicing Factor 3b, Subunit 3, 130kDa (SF3B3))
- Andere Bezeichnung
- SF3B3 (SF3B3 Produkte)
- Synonyme
- GB11574 antikoerper, rse1 antikoerper, sap130 antikoerper, sf3b130 antikoerper, staf130 antikoerper, sf3b3 antikoerper, 1810061H24Rik antikoerper, 5730409A01Rik antikoerper, AA409318 antikoerper, D8Ertd633e antikoerper, RSE1 antikoerper, SAP130 antikoerper, mKIAA0017 antikoerper, ik:tdsubc_2b2 antikoerper, wu:fb81f05 antikoerper, xx:tdsubc_2b2 antikoerper, zgc:55440 antikoerper, SF3b130 antikoerper, STAF130 antikoerper, splicing factor 3b subunit 3 antikoerper, splicing factor 3B subunit 3 antikoerper, splicing factor 3b, subunit 3, 130kDa antikoerper, splicing factor 3b subunit 3 L homeolog antikoerper, splicing factor 3b, subunit 3 antikoerper, SF3B3 antikoerper, LOC550935 antikoerper, sf3b3 antikoerper, Sf3b3 antikoerper, LOC100178056 antikoerper, sf3b3.L antikoerper
- Hintergrund
- SF3B3 is subunit 3 of the splicing factor 3b protein complex. Splicing factor 3b, together with splicing factor 3a and a 12S RNA unit, forms the U2 small nuclear ribonucleoproteins complex (U2 snRNP). The splicing factor 3b/3a complex binds pre-mRNA upstream of the intron's branch site in a sequence independent manner and may anchor the U2 snRNP to the pre-mRNA. Splicing factor 3b is also a component of the minor U12-type spliceosome. Subunit 3 has also been identified as a component of the STAGA (SPT3-TAF(II)31-GCN5L acetylase) transcription coactivator-HAT (histone acetyltransferase) complex, and the TFTC (TATA-binding-protein-free TAF(II)-containing complex). These complexes may function in chromatin modification, transcription, splicing, and DNA repair.
- Molekulargewicht
- 135 kDa (MW of target protein)
-