AARS Antikörper (C-Term)

Produktnummer ABIN633213

Produktdetails anti-AARS Antikörper

Target: AARS (Alanyl tRNA Synthetase (AARS))

Bindungsspezifität: C-Term

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser AARS Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: AARS antibody was raised against the C terminal of AARS

Aufreinigung: Affinity purified

Immunogen: AARS antibody was raised using the C terminal of AARS corresponding to a region with amino acids VTGAEAQKALRKAESLKKCLSVMEAKVKAQTAPNKDVQREIADLGEALAT

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

AARS Blocking Peptide, catalog no. 33R-9844, is also available for use as a blocking control in assays to test for specificity of this AARS antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AARS antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu AARS

Target: AARS (Alanyl tRNA Synthetase (AARS))

Andere Bezeichnung: AARS (AARS Produkte)

Synonyme: im:7146712 antikoerper, si:ch211-223o1.6 antikoerper, wu:fc48h07 antikoerper, zgc:113920 antikoerper, CMT2N antikoerper, AI316495 antikoerper, C76919 antikoerper, sti antikoerper, alanyl-tRNA synthetase antikoerper, alanyl-tRNA synthetase L homeolog antikoerper, aars antikoerper, aars.L antikoerper, AARS antikoerper, Aars antikoerper, LOC693023 antikoerper

Hintergrund: The human alanyl-tRNA synthetase (AARS) belongs to a family of tRNA synthases, of the class II enzymes. Class II tRNA synthases evolved early in evolution and are highly conserved. This is reflected by the fact that 498 of the 968-residue polypeptide human AARS shares 41% identity witht the E.coli protein. tRNA synthases are the enzymes that interpret the RNA code and attach specific aminoacids to the tRNAs that contain the cognate trinucleotide anticodons. They consist of a catalytic domain which interacts with the amino acid acceptor-T psi C helix of the tRNA, and a second domain which interacts with the rest of the tRNA structure.

Molekulargewicht: 107 kDa (MW of target protein)