SRSF1 Antikörper
-
- Target Alle SRSF1 Antikörper anzeigen
- SRSF1 (serine/arginine-Rich Splicing Factor 1 (SRSF1))
-
Reaktivität
- Human, Maus, Ratte, Zebrafisch (Danio rerio), Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SRSF1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- SFRS1 antibody was raised using a synthetic peptide corresponding to a region with amino acids EFVRKEDMTYAVRKLDNTKFRSHEGETAYIRVKVDGPRSPSYGRSRSRSR
- Top Product
- Discover our top product SRSF1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SFRS1 Blocking Peptide, catalog no. 33R-2415, is also available for use as a blocking control in assays to test for specificity of this SFRS1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SFRS1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SRSF1 (serine/arginine-Rich Splicing Factor 1 (SRSF1))
- Andere Bezeichnung
- SFRS1 (SRSF1 Produkte)
- Synonyme
- ASF antikoerper, SF2 antikoerper, SF2p33 antikoerper, SFRS1 antikoerper, SRp30a antikoerper, 1110054N12Rik antikoerper, 5730507C05Rik antikoerper, 6330415C05Rik antikoerper, AI482334 antikoerper, AW491331 antikoerper, Asf antikoerper, Sf2 antikoerper, Sfrs1 antikoerper, DKFZp469K2419 antikoerper, sfrs1 antikoerper, sfrs1b antikoerper, wu:fb80g05 antikoerper, zgc:111894 antikoerper, zgc:65898 antikoerper, zgc:76897 antikoerper, asf antikoerper, sf2 antikoerper, sf2p33 antikoerper, srp30a antikoerper, sfrs1a antikoerper, sfrs1l antikoerper, wu:fb52g10 antikoerper, wu:fb97g12 antikoerper, zgc:66146 antikoerper, serine and arginine rich splicing factor 1 antikoerper, serine/arginine-rich splicing factor 1 antikoerper, serine/arginine-rich splicing factor 1b antikoerper, serine/arginine-rich splicing factor 1 L homeolog antikoerper, serine/arginine-rich splicing factor 1a antikoerper, SRSF1 antikoerper, Srsf1 antikoerper, srsf1b antikoerper, srsf1.L antikoerper, srsf1a antikoerper
- Hintergrund
- SFRS1 is a member of the arginine/serine-rich splicing factor protein family, and functions in both constitutive and alternative pre-mRNA splicing. The protein binds to pre-mRNA transcripts and components of the spliceosome, and can either activate or repress splicing depending on the location of the pre-mRNA binding site. The protein's ability to activate splicing is regulated by phosphorylation and interactions with other splicing factor associated proteins.
- Molekulargewicht
- 27 kDa (MW of target protein)
- Pathways
- Ribonucleoprotein Complex Subunit Organization
-