KHDRBS3 Antikörper (C-Term)

Produktnummer ABIN633183

Produktdetails anti-KHDRBS3 Antikörper

Target: KHDRBS3 (KH Domain Containing, RNA Binding, Signal Transduction Associated 3 (KHDRBS3))

Bindungsspezifität: C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser KHDRBS3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: KHDRBS3 antibody was raised against the C terminal of KHDRBS3

Aufreinigung: Affinity purified

Immunogen: KHDRBS3 antibody was raised using the C terminal of KHDRBS3 corresponding to a region with amino acids EQSYDSYDNSYSTPAQSGADYYDYGHGLSEETYDSYGQEEWTNSRHKAPS

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

KHDRBS3 Blocking Peptide, catalog no. 33R-2680, is also available for use as a blocking control in assays to test for specificity of this KHDRBS3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KHDRBS3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu KHDRBS3

Target: KHDRBS3 (KH Domain Containing, RNA Binding, Signal Transduction Associated 3 (KHDRBS3))

Andere Bezeichnung: KHDRBS3 (KHDRBS3 Produkte)

Synonyme: KHDRBS3 antikoerper, T-STAR antikoerper, Etle antikoerper, SALP antikoerper, SLM-2 antikoerper, SLM2 antikoerper, TSTAR antikoerper, etoile antikoerper, Slm2 antikoerper, KH domain containing, RNA binding, signal transduction associated 3 antikoerper, KH RNA binding domain containing, signal transduction associated 3 antikoerper, KHDRBS3 antikoerper, Khdrbs3 antikoerper

Hintergrund: As a RNA-binding protein, KHDRBS3 plays a role in the regulation of alternative splicing and influences mRNA splice site selection and exon inclusion. KHDRBS3 may play a role as a negative regulator of cell growth. It inhibits cell proliferation and involved in splice site selection of vascular endothelial growth factor. It induces an increased concentration-dependent incorporation of exon in CD44 pre-mRNA by direct binding to purine-rich exonic enhancer. RNA-binding abilities are down-regulated by tyrosine kinase PTK6. It also involved in post-transcriptional regulation of HIV-1 gene expression.

Molekulargewicht: 38 kDa (MW of target protein)