GLCCI1 Antikörper (Middle Region)
-
- Target Alle GLCCI1 Antikörper anzeigen
- GLCCI1 (Glucocorticoid Induced Transcript 1 (GLCCI1))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser GLCCI1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- GLCCI1 antibody was raised against the middle region of GLCCI1
- Aufreinigung
- Affinity purified
- Immunogen
- GLCCI1 antibody was raised using the middle region of GLCCI1 corresponding to a region with amino acids PYLTGQWPRDPHVHYPSCMKDKATQTPSCWAEEGAEKRSHQRSASWGSAD
- Top Product
- Discover our top product GLCCI1 Primärantikörper
-
anti-Glucocorticoid Induced Transcript 1 (GLCCI1) (AA 226-255) antibody
GLCCI1 Reaktivität: Human WB, IHC (p) Wirt: Kaninchen Polyclonal RB32643 unconjugated
anti-Glucocorticoid Induced Transcript 1 (GLCCI1) (AA 104-133), (N-Term) antibodyGLCCI1 Reaktivität: Human, Maus WB Wirt: Kaninchen Polyclonal RB28551 unconjugated
anti-Glucocorticoid Induced Transcript 1 (GLCCI1) antibodyGLCCI1 Reaktivität: Human, Maus WB, ELISA Wirt: Kaninchen Polyclonal unconjugated
anti-Glucocorticoid Induced Transcript 1 (GLCCI1) antibodyGLCCI1 Reaktivität: Human IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-Glucocorticoid Induced Transcript 1 (GLCCI1) (AA 120-230) antibodyGLCCI1 Reaktivität: Human WB Wirt: Kaninchen Polyclonal unconjugated
anti-Glucocorticoid Induced Transcript 1 (GLCCI1) (AA 179-228) antibodyGLCCI1 Reaktivität: Human, Maus, Rind (Kuh), Pferd, Schwein, Ratte, Hund, Huhn, Affe WB Wirt: Kaninchen Polyclonal unconjugated
anti-Glucocorticoid Induced Transcript 1 (GLCCI1) (AA 255-304) antibodyGLCCI1 Reaktivität: Human, Maus, Rind (Kuh), Pferd, Schwein, Ratte, Kaninchen, Huhn WB Wirt: Kaninchen Polyclonal unconjugated
anti-Glucocorticoid Induced Transcript 1 (GLCCI1) (Middle Region) antibodyGLCCI1 Reaktivität: Human, Maus, Rind (Kuh), Pferd, Schwein, Ratte, Kaninchen, Hund, Meerschweinchen WB Wirt: Kaninchen Polyclonal unconjugated
anti-Glucocorticoid Induced Transcript 1 (GLCCI1) (AA 233-263), (Middle Region) antibodyGLCCI1 Reaktivität: Human WB, IHC (p), EIA Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
GLCCI1 Blocking Peptide, catalog no. 33R-7448, is also available for use as a blocking control in assays to test for specificity of this GLCCI1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GLCCI1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GLCCI1 (Glucocorticoid Induced Transcript 1 (GLCCI1))
- Andere Bezeichnung
- GLCCI1 (GLCCI1 Produkte)
- Synonyme
- FAM117C antikoerper, GCTR antikoerper, GIG18 antikoerper, TSSN1 antikoerper, 2310047L21Rik antikoerper, A130036A18Rik antikoerper, Fam117c antikoerper, Gig18 antikoerper, Tssn1 antikoerper, sb:cb902 antikoerper, testhymin antikoerper, zgc:158237 antikoerper, RGD1563612 antikoerper, glucocorticoid induced 1 antikoerper, glucocorticoid induced transcript 1 antikoerper, glucocorticoid induced 1a antikoerper, glucocorticoid induced 1 L homeolog antikoerper, GLCCI1 antikoerper, Glcci1 antikoerper, glcci1a antikoerper, glcci1.L antikoerper
- Hintergrund
- The function of GLCCI protein is not widely studied, and is yet to be elucidated fully.
- Molekulargewicht
- 58 kDa (MW of target protein)
-
