ZDHHC21 Antikörper (Middle Region)
-
- Target Alle ZDHHC21 Antikörper anzeigen
- ZDHHC21 (Zinc Finger, DHHC-Type Containing 21 (ZDHHC21))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ZDHHC21 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- ZDHHC21 antibody was raised against the middle region of ZDHHC21
- Aufreinigung
- Affinity purified
- Immunogen
- ZDHHC21 antibody was raised using the middle region of ZDHHC21 corresponding to a region with amino acids ELLTCYALMFSFCHYYYFLPLKKRNLDLFVFRHELAIMRLAAFMGITMLV
- Top Product
- Discover our top product ZDHHC21 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ZDHHC21 Blocking Peptide, catalog no. 33R-2559, is also available for use as a blocking control in assays to test for specificity of this ZDHHC21 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZDHHC21 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ZDHHC21 (Zinc Finger, DHHC-Type Containing 21 (ZDHHC21))
- Andere Bezeichnung
- ZDHHC21 (ZDHHC21 Produkte)
- Synonyme
- 9130404H11Rik antikoerper, AL024349 antikoerper, D130004H04Rik antikoerper, dep antikoerper, DHHC-21 antikoerper, DHHC21 antikoerper, DNZ1 antikoerper, HSPC097 antikoerper, zinc finger DHHC-type containing 21 antikoerper, zinc finger, DHHC domain containing 21 antikoerper, zinc finger, DHHC-type containing 21 antikoerper, ZDHHC21 antikoerper, zdhhc21 antikoerper, Zdhhc21 antikoerper
- Hintergrund
- The function of ZDHHC21 protein is not widely studied, and is yet to be elucidated fully.
- Molekulargewicht
- 31 kDa (MW of target protein)
-