PRSS8 Antikörper (Middle Region)

Produktnummer ABIN633110

Produktdetails anti-PRSS8 Antikörper

Target: PRSS8 (Protease, serine, 8 (PRSS8))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PRSS8 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PRSS8 antibody was raised against the middle region of PRSS8

Aufreinigung: Affinity purified

Immunogen: PRSS8 antibody was raised using the middle region of PRSS8 corresponding to a region with amino acids PITFSRYIRPICLPAANASFPNGLHCTVTGWGHVAPSVSLLTPKPLQQLE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PRSS8 Blocking Peptide, catalog no. 33R-7163, is also available for use as a blocking control in assays to test for specificity of this PRSS8 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRSS8 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PRSS8

Target: PRSS8 (Protease, serine, 8 (PRSS8))

Andere Bezeichnung: PRSS8 (PRSS8 Produkte)

Synonyme: CAP1 antikoerper, PROSTASIN antikoerper, prostasin antikoerper, 2410039E18Rik antikoerper, AI313909 antikoerper, C79772 antikoerper, fr antikoerper, mCAP1 antikoerper, protease, serine 8 antikoerper, protease, serine, 8 antikoerper, protease, serine 8 (prostasin) antikoerper, PRSS8 antikoerper, Prss8 antikoerper

Hintergrund: This gene encodes a trypsinogen, which is a member of the trypsin family of serine proteases. This enzyme is highly expressed in prostate epithelia and is one of several proteolytic enzymes found in seminal fluid. The proprotein is cleaved to produce a light chain and a heavy chain which are associated by a disulfide bond. It is active on peptide linkages involving the carboxyl group of lysine or arginine.

Molekulargewicht: 33 kDa (MW of target protein)