CSH1 Antikörper (Middle Region)

Produktnummer ABIN633099

Produktdetails anti-CSH1 Antikörper

Target: CSH1 (Chorionic Somatomammotropin Hormone 1 (Placental Lactogen) (CSH1))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CSH1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: CSH2 antibody was raised against the middle region of CSH2

Aufreinigung: Affinity purified

Immunogen: CSH2 antibody was raised using the middle region of CSH2 corresponding to a region with amino acids LFDHAMLQAHRAHQLAIDTYQEFRLEDGSRRTGQILKQTYSKFDTNSHNH

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CSH2 Blocking Peptide, catalog no. 33R-4935, is also available for use as a blocking control in assays to test for specificity of this CSH2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CSH2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CSH1

Target: CSH1 (Chorionic Somatomammotropin Hormone 1 (Placental Lactogen) (CSH1))

Andere Bezeichnung: CSH2 (CSH1 Produkte)

Synonyme: CS-1 antikoerper, CSA antikoerper, CSMT antikoerper, PL antikoerper, hCS-A antikoerper, CS-2 antikoerper, CSB antikoerper, hCS-B antikoerper, chorionic somatomammotropin hormone 1 antikoerper, chorionic somatomammotropin hormone 2 antikoerper, CSH1 antikoerper, CSH2 antikoerper

Hintergrund: The protein encoded by this gene is a member of the somatotropin/prolactin family of hormones and plays an important role in growth control. The gene is located at the growth hormone locus on chromosome 17 along with four other related genes in the same transcriptional orientation, an arrangement which is thought to have evolved by a series of gene duplications. Although the five genes share a remarkably high degree of sequence identity, they are expressed selectively in different tissues.

Molekulargewicht: 14 kDa (MW of target protein)

Pathways: Response to Growth Hormone Stimulus