FUT1 Antikörper
-
- Target Alle FUT1 Antikörper anzeigen
- FUT1 (Fucosyltransferase 1 (Galactoside 2-alpha-L-Fucosyltransferase, H Blood Group) (FUT1))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser FUT1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- FUT1 antibody was raised using a synthetic peptide corresponding to a region with amino acids EATPWKDFALLTQCNHTIMTIGTFGFWAAYLAGGDTVYLANFTLPDSEFL
- Top Product
- Discover our top product FUT1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
FUT1 Blocking Peptide, catalog no. 33R-2285, is also available for use as a blocking control in assays to test for specificity of this FUT1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FUT1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- FUT1 (Fucosyltransferase 1 (Galactoside 2-alpha-L-Fucosyltransferase, H Blood Group) (FUT1))
- Andere Bezeichnung
- FUT1 (FUT1 Produkte)
- Synonyme
- Futa antikoerper, H antikoerper, HH antikoerper, HSC antikoerper, Fut1 antikoerper, fucosyltransferase 1 antikoerper, fucosyltransferase 1 (H blood group) antikoerper, Fut1 antikoerper, FUT1 antikoerper
- Hintergrund
- The protein encoded by this gene is a Golgi stack membrane protein that is involved in the creation of a precursor of the H antigen, which is required for the final step in the soluble A and B antigen synthesis pathway. This gene is one of two encoding the galactoside 2-L-fucosyltransferase enzyme. Mutations in this gene are a cause of the H-Bombay blood group.
- Molekulargewicht
- 41 kDa (MW of target protein)
-