VAT1 Antikörper

Produktnummer ABIN633081

Produktdetails anti-VAT1 Antikörper

Target: VAT1 (Vesicle Amine Transport 1 (VAT1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser VAT1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: VAT1 antibody was raised using a synthetic peptide corresponding to a region with amino acids PPAPGPGQLTLRLRACGLNFADLMARQGLYDRLPPLPVTPGMEGAGVVIA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

VAT1 Blocking Peptide, catalog no. 33R-7240, is also available for use as a blocking control in assays to test for specificity of this VAT1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VAT1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu VAT1

Target: VAT1 (Vesicle Amine Transport 1 (VAT1))

Andere Bezeichnung: VAT1 (VAT1 Produkte)

Synonyme: VATI antikoerper, VAT-1 antikoerper, SLC18A1 antikoerper, si:dz163l24.2 antikoerper, Protein MIB antikoerper, vat1 antikoerper, vesicle amine transport 1 antikoerper, vesicle amine transport 1 L homeolog antikoerper, VAT1 antikoerper, Vat1 antikoerper, vat1 antikoerper, vat1.L antikoerper

Hintergrund: Synaptic vesicles are responsible for regulating the storage and release of neurotransmitters in the nerve terminal. The protein encoded by this gene is an abundant integral membrane protein of cholinergic synaptic vesicles and is thought to be involved in vesicular transport. It belongs to the quinone oxidoreductase subfamily of zinc-containing alcohol dehydrogenase proteins.

Molekulargewicht: 42 kDa (MW of target protein)