ITLN2 Antikörper (Middle Region)
-
- Target Alle ITLN2 Antikörper anzeigen
- ITLN2 (Intelectin 2 (ITLN2))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ITLN2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- ITLN2 antibody was raised against the middle region of ITLN2
- Aufreinigung
- Affinity purified
- Immunogen
- ITLN2 antibody was raised using the middle region of ITLN2 corresponding to a region with amino acids TVGDRWSSQQGNKADYPEGDGNWANYNTFGSAEAATSDDYKNPGYYDIQA
- Top Product
- Discover our top product ITLN2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ITLN2 Blocking Peptide, catalog no. 33R-9353, is also available for use as a blocking control in assays to test for specificity of this ITLN2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ITLN2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ITLN2 (Intelectin 2 (ITLN2))
- Andere Bezeichnung
- ITLN2 (ITLN2 Produkte)
- Synonyme
- HL2 antikoerper, HL-2 antikoerper, hl2 antikoerper, hl-2 antikoerper, MGC80711 antikoerper, itln1 antikoerper, MGC186157 antikoerper, itln3 antikoerper, intelectin 2 antikoerper, intelectin 2 L homeolog antikoerper, ITLN2 antikoerper, itln2.L antikoerper, itln2 antikoerper
- Hintergrund
- ITLN2 may play a role in the defense system against pathogens.
- Molekulargewicht
- 36 kDa (MW of target protein)
-