HSD3B7 Antikörper (Middle Region)

Produktnummer ABIN633064

Produktdetails anti-HSD3B7 Antikörper

Target: HSD3B7 (Hydroxy-delta-5-Steroid Dehydrogenase, 3 beta- and Steroid delta-Isomerase 7 (HSD3B7))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HSD3B7 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: HSD3 B7 antibody was raised against the middle region of HSD3 7

Aufreinigung: Affinity purified

Immunogen: HSD3 B7 antibody was raised using the middle region of HSD3 7 corresponding to a region with amino acids QGTRNVIEACVQTGTRFLVYTSSMEVVGPNTKGHPFYRGNEDTPYEAVHR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

HSD3B7 Blocking Peptide, catalog no. 33R-7574, is also available for use as a blocking control in assays to test for specificity of this HSD3B7 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HSD0 7 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu HSD3B7

Target: HSD3B7 (Hydroxy-delta-5-Steroid Dehydrogenase, 3 beta- and Steroid delta-Isomerase 7 (HSD3B7))

Andere Bezeichnung: HSD3B7 (HSD3B7 Produkte)

Synonyme: CBAS1 antikoerper, PFIC4 antikoerper, SDR11E3 antikoerper, AI195443 antikoerper, BB098564 antikoerper, Cca2 antikoerper, hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 7 antikoerper, HSD3B7 antikoerper, Hsd3b7 antikoerper

Hintergrund: This gene encodes an enzyme which is involved in the initial stages of the synthesis of bile acids from cholesterol and a member of the short-chain dehydrogenase/reductase superfamily. The encoded protein is a membrane-associated endoplasmic reticulum protein which is active against 7-alpha hydrosylated sterol substrates. Mutations in this gene are associated with a congenital bile acid synthesis defect which leads to neonatal cholestasis, a form of progressive liver disease. Multiple transcript variants encoding different isoforms have been found for this gene.

Molekulargewicht: 41 kDa (MW of target protein)