DCC Antikörper (Middle Region)

Produktnummer ABIN633057

Produktdetails anti-DCC Antikörper

Target: DCC (Deleted in Colorectal Carcinoma (DCC))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DCC Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: DCC antibody was raised against the middle region of DCC

Aufreinigung: Affinity purified

Immunogen: DCC antibody was raised using the middle region of DCC corresponding to a region with amino acids PIGQMHPPHGSVTPQKNSNLLVIIVVTVGVITVLVVVIVAVICTRRSSAQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DCC Blocking Peptide, catalog no. 33R-7153, is also available for use as a blocking control in assays to test for specificity of this DCC antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DCC antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DCC

Target: DCC (Deleted in Colorectal Carcinoma (DCC))

Andere Bezeichnung: DCC (DCC Produkte)

Synonyme: CRC18 antikoerper, CRCR1 antikoerper, IGDCC1 antikoerper, MRMV1 antikoerper, DCC antikoerper, zdcc antikoerper, C030036D22Rik antikoerper, Igdcc1 antikoerper, xdcc antikoerper, XDCCa antikoerper, dcca-A antikoerper, Dcc antikoerper, DCC netrin 1 receptor antikoerper, deleted in colorectal carcinoma antikoerper, netrin receptor DCC antikoerper, DCC antikoerper, dcc antikoerper, Dcc antikoerper, LOC100712666 antikoerper

Hintergrund: This gene encodes a netrin 1 receptor. The transmembrane protein is a member of the immunoglobulin superfamily of cell adhesion molecules, and mediates axon guidance of neuronal growth cones towards sources of netrin 1 ligand. The cytoplasmic tail interacts with the tyrosine kinases Src and focal adhesion kinase (FAK, also known as PTK2) to mediate axon attraction. The protein partially localizes to lipid rafts, and induces apoptosis in the absence of ligand. The protein functions as a tumor suppressor, and is frequently mutated or downregulated in colorectal cancer and esophageal carcinoma.

Molekulargewicht: 158 kDa (MW of target protein)

Pathways: Regulation of Cell Size