CRLF2 Antikörper (Middle Region)

Produktnummer ABIN633053

Produktdetails anti-CRLF2 Antikörper

Target: CRLF2 (Cytokine Receptor-Like Factor 2 (CRLF2))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CRLF2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: CRLF2 antibody was raised against the middle region of CRLF2

Aufreinigung: Affinity purified

Immunogen: CRLF2 antibody was raised using the middle region of CRLF2 corresponding to a region with amino acids FWVRVKAMEDVYGPDTYPSDWSEVTCWQRGEIRDACAETPTPPKPKLSKF

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CRLF2 Blocking Peptide, catalog no. 33R-3132, is also available for use as a blocking control in assays to test for specificity of this CRLF2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CRLF2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CRLF2

Target: CRLF2 (Cytokine Receptor-Like Factor 2 (CRLF2))

Andere Bezeichnung: CRLF2 (CRLF2 Produkte)

Synonyme: CRLF2 antikoerper, CRL2 antikoerper, CRLF2Y antikoerper, TSLPR antikoerper, CRLM2 antikoerper, Ly114 antikoerper, Tpte2 antikoerper, Tslpr antikoerper, Crl2 antikoerper, cytokine receptor like factor 2 antikoerper, cytokine receptor-like factor 2 antikoerper, CRLF2 antikoerper, Crlf2 antikoerper

Hintergrund: Cytokine signals are mediated through specific receptor complexes, the components of which are mostly members of the type I cytokine receptor family. Type I cytokine receptors share conserved structural features in their extracellular domain. Receptor complexes are typically heterodimeric, consisting of alpha chains, which provide ligand specificity, and beta (or gamma) chains, which are required for the formation of high-affinity binding sites and signal transduction.

Molekulargewicht: 29 kDa (MW of target protein)