OMA1 Antikörper
-
- Target Alle OMA1 Antikörper anzeigen
- OMA1 (OMA1 Zinc Metallopeptidase Homolog (OMA1))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser OMA1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- OMA1 antibody was raised using a synthetic peptide corresponding to a region with amino acids WAICPRDSLALLCQWIQSKLQEYMFNRPYSRKLEAEADKIGLLLAAKACA
- Top Product
- Discover our top product OMA1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
OMA1 Blocking Peptide, catalog no. 33R-9932, is also available for use as a blocking control in assays to test for specificity of this OMA1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OMA1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- OMA1 (OMA1 Zinc Metallopeptidase Homolog (OMA1))
- Andere Bezeichnung
- OMA1 (OMA1 Produkte)
- Synonyme
- 2010001O09Rik antikoerper, DAB1 antikoerper, MPRP-1 antikoerper, YKR087C antikoerper, ZMPOMA1 antikoerper, peptidase antikoerper, RGD1304821 antikoerper, oma1 antikoerper, OMA1 zinc metallopeptidase antikoerper, si:ch73-215a11.1 antikoerper, olfactory receptor 4K2 antikoerper, OMA1 antikoerper, Oma1 antikoerper, si:ch73-215a11.1 antikoerper, LOC531304 antikoerper
- Hintergrund
- OMA1 is a mitochondrial protease.
- Molekulargewicht
- 60 kDa (MW of target protein)
-