UTP14A Antikörper

Produktnummer ABIN633033

Produktdetails anti-UTP14A Antikörper

Target: UTP14A (UTP14, U3 Small Nucleolar Ribonucleoprotein, Homolog A (UTP14A))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser UTP14A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: UTP14 A antibody was raised using a synthetic peptide corresponding to a region with amino acids KWDPVVLKNRQAEQLVFPLEKEEPAIAPIEHVLSGWKARTPLEQEIFNLL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

UTP14A Blocking Peptide, catalog no. 33R-4729, is also available for use as a blocking control in assays to test for specificity of this UTP14A antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UTP10 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu UTP14A

Target: UTP14A (UTP14, U3 Small Nucleolar Ribonucleoprotein, Homolog A (UTP14A))

Andere Bezeichnung: UTP14A (UTP14A Produkte)

Synonyme: NYCO16 antikoerper, SDCCAG16 antikoerper, dJ537K23.3 antikoerper, 2700066J21Rik antikoerper, JsdX antikoerper, NY-CO-16 antikoerper, T25628 antikoerper, mKIAA0266 antikoerper, UTP14C antikoerper, UTP14A antikoerper, utp14a antikoerper, UTP14A, small subunit processome component antikoerper, UTP14A small subunit processome component antikoerper, UTP14, U3 small nucleolar ribonucleoprotein, homolog A-like antikoerper, U3 small nucleolar RNA-associated protein 14 homolog A antikoerper, UTP14A, small subunit processome component L homeolog antikoerper, UTP14A antikoerper, Utp14a antikoerper, LOC505600 antikoerper, LOC100083222 antikoerper, utp14a.L antikoerper

Hintergrund: This gene encodes a member of the uridine triphosphate 14 family. As an essential component of a large ribonucleoprotein complex bound to the U3 small nucleolar RNA, the encoded protein is involved in ribosome biogenesis and 18S rRNA synthesis. An autosomal retrotransposed copy of this X-linked gene exists on chromosome 13. Alternative splicing results in multiple transcript variants.

Molekulargewicht: 88 kDa (MW of target protein)