APIP Antikörper (Middle Region)
-
- Target Alle APIP Antikörper anzeigen
- APIP (APAF1 Interacting Protein (APIP))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser APIP Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- APIP antibody was raised against the middle region of APIP
- Aufreinigung
- Affinity purified
- Immunogen
- APIP antibody was raised using the middle region of APIP corresponding to a region with amino acids GIKKCTSGGYYRYDDMLVVPIIENTPEEKDLKDRMAHAMNEYPDSCAVLV
- Top Product
- Discover our top product APIP Primärantikörper
-
anti-APAF1 Interacting Protein (APIP) (AA 1-242) antibody
APIP Reaktivität: Human WB, ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-APAF1 Interacting Protein (APIP) (AA 111-142) antibodyAPIP Reaktivität: Human WB, IHC (p) Wirt: Kaninchen Polyclonal RB55049 unconjugated
anti-APAF1 Interacting Protein (APIP) (AA 143-192) antibodyAPIP Reaktivität: Human, Maus, Ratte, Meerschweinchen, Kaninchen, Rind (Kuh), Hund, Zebrafisch (Danio rerio), Hamster, Affe, Fledermaus, Schwein, Huhn WB Wirt: Kaninchen Polyclonal unconjugated
anti-APAF1 Interacting Protein (APIP) antibodyAPIP Reaktivität: Human WB Wirt: Maus Monoclonal 19F461 unconjugated
anti-APAF1 Interacting Protein (APIP) (Middle Region) antibodyAPIP Reaktivität: Human, Maus, Ratte, Meerschweinchen, Kaninchen, Rind (Kuh), Hund, Pferd, Zebrafisch (Danio rerio), Saccharomyces cerevisiae WB Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
APIP Blocking Peptide, catalog no. 33R-3330, is also available for use as a blocking control in assays to test for specificity of this APIP antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of APIP antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- APIP (APAF1 Interacting Protein (APIP))
- Andere Bezeichnung
- APIP (APIP Produkte)
- Synonyme
- APIP2 antikoerper, CGI29 antikoerper, MMRP19 antikoerper, dJ179L10.2 antikoerper, hAPIP antikoerper, CGI-29 antikoerper, Mmrp19 antikoerper, RGD1564562 antikoerper, zgc:103619 antikoerper, APAF1 interacting protein antikoerper, APAF1 interacting protein S homeolog antikoerper, APIP antikoerper, Apip antikoerper, apip antikoerper, apip.S antikoerper
- Hintergrund
- APIP is an APAF1-interacting protein that acts as a negative regulator of ischemic/hypoxic injury.
- Molekulargewicht
- 27 kDa (MW of target protein)
- Pathways
- Methionine Biosynthetic Process
-
