SDR9C7 Antikörper (Middle Region)
-
- Target Alle SDR9C7 Antikörper anzeigen
- SDR9C7 (Short Chain Dehydrogenase/reductase Family 9C, Member 7 (SDR9C7))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SDR9C7 Antikörper ist unkonjugiert
- Applikation
- Western Blotting (WB)
- Spezifität
- SDR-O antibody was raised against the middle region of SDR-O
- Aufreinigung
- Affinity purified
- Immunogen
- SDR-O antibody was raised using the middle region of SDR-O corresponding to a region with amino acids SMEHAIVSRSPRIRYNPGLDAKLLYIPLAKLPTPVTDFILSRYLPRPADS
- Top Product
- Discover our top product SDR9C7 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SDR-O Blocking Peptide, catalog no. 33R-10433, is also available for use as a blocking control in assays to test for specificity of this SDR-O antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SDR-O antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SDR9C7 (Short Chain Dehydrogenase/reductase Family 9C, Member 7 (SDR9C7))
- Andere Bezeichnung
- SDR-O (SDR9C7 Produkte)
- Synonyme
- RDHS antikoerper, SDR-O antikoerper, SDRO antikoerper, 1810054F20Rik antikoerper, Rdh20 antikoerper, Rdhs antikoerper, Sdro antikoerper, Sdr-o antikoerper, short chain dehydrogenase/reductase family 9C member 7 antikoerper, 4short chain dehydrogenase/reductase family 9C, member 7 antikoerper, short chain dehydrogenase/reductase family 9C, member 7 antikoerper, SDR9C7 antikoerper, Sdr9c7 antikoerper
- Hintergrund
- SDR-O displays weak conversion of all-trans-retinal to all-trans-retinol in the presence of NADH. Has apparently no steroid dehydrogenase activity.
- Molekulargewicht
- 35 kDa (MW of target protein)
-