CPEB3 Antikörper (Middle Region)
-
- Target Alle CPEB3 Antikörper anzeigen
- CPEB3 (Cytoplasmic Polyadenylation Element Binding Protein 3 (CPEB3))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Ratte, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CPEB3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- CPEB3 antibody was raised against the middle region of CPEB3
- Aufreinigung
- Affinity purified
- Immunogen
- CPEB3 antibody was raised using the middle region of CPEB3 corresponding to a region with amino acids RTDNGNNLLPFQDRSRPYDTFNLHSLENSLMDMIRTDHEPLKGKHYPPSG
- Top Product
- Discover our top product CPEB3 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
CPEB3 Blocking Peptide, catalog no. 33R-8220, is also available for use as a blocking control in assays to test for specificity of this CPEB3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CPEB3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CPEB3 (Cytoplasmic Polyadenylation Element Binding Protein 3 (CPEB3))
- Andere Bezeichnung
- CPEB3 (CPEB3 Produkte)
- Synonyme
- si:ch211-129m12.2 antikoerper, 4831444O18Rik antikoerper, mKIAA0940 antikoerper, RGD1564670 antikoerper, cytoplasmic polyadenylation element binding protein 3 antikoerper, cpeb3 antikoerper, CPEB3 antikoerper, LOAG_07772 antikoerper, Cpeb3 antikoerper
- Hintergrund
- The function of CPEB3 protein has not been widely studied, and is yet to be fully elucidated.
- Molekulargewicht
- 76 kDa (MW of target protein)
-