DIP2A Antikörper

Produktnummer ABIN632976

Produktdetails anti-DIP2A Antikörper

Target: DIP2A (DIP2 Disco-Interacting Protein 2 Homolog A (DIP2A))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DIP2A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: DIP2 A antibody was raised using a synthetic peptide corresponding to a region with amino acids PLKEFFVDDFEELLEVQQPDPNQPKPEGSETSVLRGEPLTAGVPRPPSLL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DIP2A Blocking Peptide, catalog no. 33R-7196, is also available for use as a blocking control in assays to test for specificity of this DIP2A antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DIP0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DIP2A

Target: DIP2A (DIP2 Disco-Interacting Protein 2 Homolog A (DIP2A))

Andere Bezeichnung: DIP2A (DIP2A Produkte)

Synonyme: C21orf106 antikoerper, Dip2-like antikoerper, DIP2 antikoerper, 4931420H10Rik antikoerper, AI426328 antikoerper, Dip2 antikoerper, Kiaa0184-hp antikoerper, mKIAA0184 antikoerper, disco-interacting protein 2 homolog A antikoerper, disco interacting protein 2 homolog A antikoerper, Dip2a antikoerper, DIP2A antikoerper

Hintergrund: The protein encoded by this gene may be involved in axon patterning in the central nervous system. This gene is not highly expressed. Several transcript variants encoding different isoforms have been found for this gene.

Molekulargewicht: 170 kDa (MW of target protein)

Pathways: M Phase