SPATA7 Antikörper (Middle Region)

Produktnummer ABIN632947

Produktdetails anti-SPATA7 Antikörper

Target: SPATA7 (Spermatogenesis Associated 7 (SPATA7))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SPATA7 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: SPATA7 antibody was raised against the middle region of SPATA7

Aufreinigung: Affinity purified

Immunogen: SPATA7 antibody was raised using the middle region of SPATA7 corresponding to a region with amino acids FLSQYRYYTPAKRKKDFTDQRIEAETQTELSFKSELGTAETKNMTDSEMN

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SPATA7 Blocking Peptide, catalog no. 33R-2989, is also available for use as a blocking control in assays to test for specificity of this SPATA7 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SPATA7 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SPATA7

Target: SPATA7 (Spermatogenesis Associated 7 (SPATA7))

Andere Bezeichnung: SPATA7 (SPATA7 Produkte)

Synonyme: HSD-3.1 antikoerper, HSD3 antikoerper, LCA3 antikoerper, AI661438 antikoerper, B230306G18Rik antikoerper, RSD-3 antikoerper, Wmp1 antikoerper, spermatogenesis associated 7 antikoerper, SPATA7 antikoerper, Spata7 antikoerper

Hintergrund: The gene which encodes the SPATA7 protein is also expressed in retina. Mutations in this gene are associated with Leber congenital amaurosis and juvenile retinitis pigmentosa. Alternatively spliced transcript variants encoding different isoforms have been found.

Molekulargewicht: 68 kDa (MW of target protein)