LRRC20 Antikörper (Middle Region)

Produktnummer ABIN632945

Produktdetails anti-LRRC20 Antikörper

Target: LRRC20 (Leucine Rich Repeat Containing 20 (LRRC20))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LRRC20 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: LRRC20 antibody was raised against the middle region of LRRC20

Aufreinigung: Affinity purified

Immunogen: LRRC20 antibody was raised using the middle region of LRRC20 corresponding to a region with amino acids TTFSQLRELHLEGNFLHRLPSEVSALQHLKAIDLSRNQFQDFPEQLTALP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LRRC20 Blocking Peptide, catalog no. 33R-9314, is also available for use as a blocking control in assays to test for specificity of this LRRC20 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRRC20 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu LRRC20

Target: LRRC20 (Leucine Rich Repeat Containing 20 (LRRC20))

Andere Bezeichnung: LRRC20 (LRRC20 Produkte)

Synonyme: BC036304 antikoerper, leucine rich repeat containing 20 antikoerper, LRRC20 antikoerper, Lrrc20 antikoerper

Hintergrund: The function of LRRC20 protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 20 kDa (MW of target protein)