SMG8 Antikörper (Middle Region)

Produktnummer ABIN632938

Produktdetails anti-SMG8 Antikörper

Target: SMG8 (Smg-8 Homolog, Nonsense Mediated mRNA Decay Factor (SMG8))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SMG8 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: C17 ORF71 antibody was raised against the middle region of C17 rf71

Aufreinigung: Affinity purified

Immunogen: C17 ORF71 antibody was raised using the middle region of C17 rf71 corresponding to a region with amino acids HCVHKFHSLPKSGEKPEADRNPPVLYHNSRARSTGACNCGRKQAPRDDPF

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C17ORF71 Blocking Peptide, catalog no. 33R-3702, is also available for use as a blocking control in assays to test for specificity of this C17ORF71 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF71 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SMG8

Target: SMG8 (Smg-8 Homolog, Nonsense Mediated mRNA Decay Factor (SMG8))

Andere Bezeichnung: C17ORF71 (SMG8 Produkte)

Synonyme: C17orf71 antikoerper, 1200011M11Rik antikoerper, C19H17orf71 antikoerper, SMG8, nonsense mediated mRNA decay factor antikoerper, smg-8 homolog, nonsense mediated mRNA decay factor (C. elegans) antikoerper, Protein smg-8 antikoerper, SMG8 antikoerper, Smg8 antikoerper, smg-8 antikoerper

Hintergrund: The C17ORF71 protein is a component of the SMG1C complex, a mRNA surveillance complex that recognises and degrades mRNAs containing premature translation termination codons (PTCs) via the nonsense-mediated mRNA decay (NMD). The complex probably acts by associating with ribosomes during tranlation termination on mRNPs. If an exon junction complex (EJC) is located 50-55 or more nucleotides downstream from the termination codon, SMG1 phosphorylates UPF1/RENT1, triggering nonsense-mediated mRNA decay (NMD).

Molekulargewicht: 110 kDa (MW of target protein)