RPE Antikörper (Middle Region)
-
- Target Alle RPE Antikörper anzeigen
- RPE (Ribulose-5-Phosphate-3-Epimerase (RPE))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser RPE Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- RPE antibody was raised against the middle region of RPE
- Aufreinigung
- Affinity purified
- Immunogen
- RPE antibody was raised using the middle region of RPE corresponding to a region with amino acids MMVSKPEQWVKPMAVAGANQYTFHLEATENPGALIKDIRENGMKVGLAIK
- Top Product
- Discover our top product RPE Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
RPE Blocking Peptide, catalog no. 33R-6239, is also available for use as a blocking control in assays to test for specificity of this RPE antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPE antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RPE (Ribulose-5-Phosphate-3-Epimerase (RPE))
- Andere Bezeichnung
- RPE (RPE Produkte)
- Synonyme
- wu:fa07h08 antikoerper, wu:fb93d11 antikoerper, wu:fc20b11 antikoerper, ik:tdsubc_2c8 antikoerper, xx:tdsubc_2c8 antikoerper, RPE2-1 antikoerper, 2810429B02Rik antikoerper, 5730518J08Rik antikoerper, ribulose-5-phosphate-3-epimerase antikoerper, rpe antikoerper, RPE antikoerper, Rpe antikoerper
- Hintergrund
- The function of RPE protein is not widely studied, and is yet to be elucidated fully.
- Molekulargewicht
- 25 kDa (MW of target protein)
-