RP2 Antikörper

Produktnummer ABIN632908

Produktdetails anti-RP2 Antikörper

Target: RP2 (Retinitis Pigmentosa 2 (X-Linked Recessive) (RP2))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RP2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: RP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LEFNGDGAVEVCQLIVNEIFNGTKMFVSESKETASGDVDSFYNFADIQMG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RP2 Blocking Peptide, catalog no. 33R-4895, is also available for use as a blocking control in assays to test for specificity of this RP2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RP2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RP2

Target: RP2 (Retinitis Pigmentosa 2 (X-Linked Recessive) (RP2))

Andere Bezeichnung: RP2 (RP2 Produkte)

Synonyme: Rp2h antikoerper, RGD1565124 antikoerper, RP2 antikoerper, wu:fj10e02 antikoerper, wu:fm72d05 antikoerper, zfrp2 antikoerper, zgc:55632 antikoerper, DELXp11.3 antikoerper, NM23-H10 antikoerper, NME10 antikoerper, TBCCD2 antikoerper, XRP2 antikoerper, AI662636 antikoerper, Rp2 antikoerper, RP2, ARL3 GTPase activating protein antikoerper, XRP2 protein antikoerper, XRP2-like protein antikoerper, retinitis pigmentosa 2 (X-linked recessive) antikoerper, RP2, ARL3 GTPase activating protein S homeolog antikoerper, retinitis pigmentosa 2 homolog antikoerper, Rp2 antikoerper, RP2 antikoerper, Bm1_36735 antikoerper, PITG_13367 antikoerper, LOAG_11813 antikoerper, rp2 antikoerper, rp2.S antikoerper

Hintergrund: The RP2 locus has been implicated as one cause of X-linked retinitis pigmentosa. The predicted gene product shows homology with human cofactor C, a protein involved in the ultimate step of beta-tubulin folding.

Molekulargewicht: 40 kDa (MW of target protein)

Pathways: Nucleotide Phosphorylation, Ribonucleoside Biosynthetic Process