PSMC4 Antikörper

Produktnummer ABIN632907

Produktdetails anti-PSMC4 Antikörper

Target: PSMC4 (Proteasome (Prosome, Macropain) 26S Subunit, ATPase, 4 (PSMC4))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PSMC4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: PSMC4 antibody was raised using a synthetic peptide corresponding to a region with amino acids MEEIGILVEKAQDEIPALSVSRPQTGLSFLGPEPEDLEDLYSRYKKLQQE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PSMC4 Blocking Peptide, catalog no. 33R-5903, is also available for use as a blocking control in assays to test for specificity of this PSMC4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PSMC4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PSMC4

Target: PSMC4 (Proteasome (Prosome, Macropain) 26S Subunit, ATPase, 4 (PSMC4))

Andere Bezeichnung: PSMC4 (PSMC4 Produkte)

Synonyme: NCU02260.1 antikoerper, AO090003000692 antikoerper, DDBDRAFT_0188209 antikoerper, DDBDRAFT_0191435 antikoerper, DDB_0188209 antikoerper, DDB_0191435 antikoerper, MIP224 antikoerper, RPT3 antikoerper, S6 antikoerper, TBP-7 antikoerper, TBP7 antikoerper, CIP21 antikoerper, Tbp7 antikoerper, 26S protease regulatory subunit 6B antikoerper, regulatory particle, ATPase-like-3 antikoerper, 26S proteasome regulatory subunit 6B antikoerper, proteasome 26S subunit, ATPase 4 antikoerper, proteasome (prosome, macropain) 26S subunit, ATPase, 4 antikoerper, LOC732870 antikoerper, rpt-3 antikoerper, ATEG_04674 antikoerper, LELG_01296 antikoerper, HCAG_00039 antikoerper, LOC5568998 antikoerper, GL50803_7950 antikoerper, EDI_044950 antikoerper, AOR_1_1218154 antikoerper, PTRG_03339 antikoerper, psmC4 antikoerper, prs6b antikoerper, LOC100381342 antikoerper, psmc4 antikoerper, PSMC4 antikoerper, Psmc4 antikoerper

Hintergrund: The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator.

Molekulargewicht: 47 kDa (MW of target protein)

Pathways: Mitotic G1-G1/S Phases, DNA Replication, Synthesis of DNA, Ubiquitin Proteasome Pathway