C18orf32 Antikörper (Middle Region)

Produktnummer ABIN632881

Produktdetails anti-C18orf32 Antikörper

Target: C18orf32 (Chromosome 18 Open Reading Frame 32 (C18orf32))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser C18orf32 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: C18 ORF32 antibody was raised against the middle region of C18 rf32

Aufreinigung: Affinity purified

Immunogen: C18 ORF32 antibody was raised using the middle region of C18 rf32 corresponding to a region with amino acids PLVSPFVSRIWPKKAIQESNDTNKGKVNFKGADMNGLPTKGPTEICDKKK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C18ORF32 Blocking Peptide, catalog no. 33R-7213, is also available for use as a blocking control in assays to test for specificity of this C18ORF32 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF32 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu C18orf32

Target: C18orf32 (Chromosome 18 Open Reading Frame 32 (C18orf32))

Andere Bezeichnung: C18ORF32 (C18orf32 Produkte)

Synonyme: chromosome 18 open reading frame 32 antikoerper, chromosome Z open reading frame, human C18orf32 antikoerper, C18orf32 antikoerper, CZH18ORF32 antikoerper, c18orf32 antikoerper

Hintergrund: The C18ORF32 protein may activate the NF-kappa-B signaling pathway.

Molekulargewicht: 9 kDa (MW of target protein)