MAU2/KIAA0892 Antikörper (Middle Region)

Produktnummer ABIN632809

Produktdetails anti-MAU2/KIAA0892 Antikörper

Target: MAU2/KIAA0892 (MAU2) (MAU2 Sister Chromatid Cohesion Factor (MAU2))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MAU2/KIAA0892 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: KIAA0892 antibody was raised against the middle region of KIAA0892

Aufreinigung: Affinity purified

Immunogen: KIAA0892 antibody was raised using the middle region of KIAA0892 corresponding to a region with amino acids MHQNFSQQLLQDHIEACSLPEHNLITWTDGPPPVQFQAQNGPNTSLASLL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

KIAA0892 Blocking Peptide, catalog no. 33R-6099, is also available for use as a blocking control in assays to test for specificity of this KIAA0892 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIAA0892 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MAU2/KIAA0892

Target: MAU2/KIAA0892 (MAU2) (MAU2 Sister Chromatid Cohesion Factor (MAU2))

Andere Bezeichnung: KIAA0892 (MAU2 Produkte)

Synonyme: scc4 antikoerper, mau-2 antikoerper, kiaa0892 antikoerper, 9130404D08Rik antikoerper, A930019L04Rik antikoerper, C77863 antikoerper, C79014 antikoerper, Mau-2 antikoerper, mKIAA0892 antikoerper, KIAA0892 antikoerper, MAU2L antikoerper, SCC4 antikoerper, MAU2 sister chromatid cohesion factor antikoerper, MAU2, sister chromatid cohesion factor antikoerper, MAU2, sister chromatid cohesion factor S homeolog antikoerper, MAU2 antikoerper, mau2 antikoerper, mau2.S antikoerper, Mau2 antikoerper

Hintergrund: KIAA0892 belongs to the mau-2 family. It contains 4 TPR repeats. The function of KIAA0892 remains unknown.

Molekulargewicht: 69 kDa (MW of target protein)