CPNE9 Antikörper (Middle Region)

Produktnummer ABIN632764

Produktdetails anti-CPNE9 Antikörper

Target: CPNE9 (Copine IX (CPNE9))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CPNE9 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: Copine IX antibody was raised against the middle region of CPNE9

Aufreinigung: Affinity purified

Immunogen: Copine IX antibody was raised using the middle region of CPNE9 corresponding to a region with amino acids YDRTVKIDVYDWDRDGSHDFIGEFTTSYRELSKAQNQFTVYEVLNPRKKC

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Copine IX Blocking Peptide, catalog no. 33R-10075, is also available for use as a blocking control in assays to test for specificity of this Copine IX antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CPNE9 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CPNE9

Target: CPNE9 (Copine IX (CPNE9))

Andere Bezeichnung: Copine IX (CPNE9 Produkte)

Synonyme: A730016F12Rik antikoerper, mKIAA4217 antikoerper, RGD1309212 antikoerper, copine family member 9 antikoerper, copine family member IX antikoerper, CPNE9 antikoerper, Cpne9 antikoerper

Hintergrund: CPNE9 may function in membrane trafficking. It exhibits calcium-dependent phospholipid binding properties.

Molekulargewicht: 62 kDa (MW of target protein)