C11ORF74 Antikörper (Middle Region)

Produktnummer ABIN632721

Produktdetails anti-C11ORF74 Antikörper

Target: C11ORF74 (Chromosome 11 Open Reading Frame 74 (C11ORF74))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser C11ORF74 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: C11 ORF74 antibody was raised against the middle region of C11 rf74

Aufreinigung: Affinity purified

Immunogen: C11 ORF74 antibody was raised using the middle region of C11 rf74 corresponding to a region with amino acids VQLFSLDEEFDYDNVMLTSKFSPAEIENIKELCKQQKRKDTSPDLEKSCD

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C11ORF74 Blocking Peptide, catalog no. 33R-9749, is also available for use as a blocking control in assays to test for specificity of this C11ORF74 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF74 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu C11ORF74

Target: C11ORF74 (Chromosome 11 Open Reading Frame 74 (C11ORF74))

Andere Bezeichnung: C11ORF74 (C11ORF74 Produkte)

Synonyme: HEPIS antikoerper, chromosome 11 open reading frame 74 antikoerper, chromosome 5 C11orf74 homolog antikoerper, C11orf74 antikoerper, C5H11orf74 antikoerper, c11orf74 antikoerper

Hintergrund: The function of C11orf74 protein has not been widely studied, and is yet to be fully elucidated.

Molekulargewicht: 25 kDa (MW of target protein)