GPRASP2 Antikörper (Middle Region)
-
- Target Alle GPRASP2 Antikörper anzeigen
- GPRASP2 (G Protein-Coupled Receptor Associated Sorting Protein 2 (GPRASP2))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser GPRASP2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- GPRASP2 antibody was raised against the middle region of GPRASP2
- Aufreinigung
- Affinity purified
- Immunogen
- GPRASP2 antibody was raised using the middle region of GPRASP2 corresponding to a region with amino acids EQESLLQPDQPSPEFTFQYDPSYRSVREIREHLRARESAESESWSCSCIQ
- Top Product
- Discover our top product GPRASP2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
GPRASP2 Blocking Peptide, catalog no. 33R-2662, is also available for use as a blocking control in assays to test for specificity of this GPRASP2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GPRASP2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GPRASP2 (G Protein-Coupled Receptor Associated Sorting Protein 2 (GPRASP2))
- Andere Bezeichnung
- GPRASP2 (GPRASP2 Produkte)
- Synonyme
- GASP2 antikoerper, 5330440H13Rik antikoerper, Prpl5 antikoerper, RGD1561019 antikoerper, G protein-coupled receptor associated sorting protein 2 antikoerper, GPRASP2 antikoerper, Gprasp2 antikoerper
- Hintergrund
- The function of FAM14A protein has not been widely studied, and is yet to be fully elucidated.
- Molekulargewicht
- 94 kDa (MW of target protein)
-