PPP3CA Antikörper

Produktnummer ABIN632686

Produktdetails anti-PPP3CA Antikörper

Target: PPP3CA (Protein Phosphatase 3, Catalytic Subunit, alpha Isoform (PPP3CA))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PPP3CA Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: PPP3 CA antibody was raised using a synthetic peptide corresponding to a region with amino acids LPSGVLSGGKQTLQSATVEAIEADEAIKGFSPQHKITSFEEAKGLDRINE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PPP3CA Blocking Peptide, catalog no. 33R-5289, is also available for use as a blocking control in assays to test for specificity of this PPP3CA antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPP0 A antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PPP3CA

Target: PPP3CA (Protein Phosphatase 3, Catalytic Subunit, alpha Isoform (PPP3CA))

Andere Bezeichnung: PPP3CA (PPP3CA Produkte)

Synonyme: CALN antikoerper, CALNA antikoerper, CALNA1 antikoerper, CCN1 antikoerper, CNA1 antikoerper, PPP2B antikoerper, 2900074D19Rik antikoerper, AI841391 antikoerper, AW413465 antikoerper, CN antikoerper, Caln antikoerper, Calna antikoerper, CnA antikoerper, Calna1 antikoerper, calcineurin antikoerper, caln antikoerper, calna antikoerper, calna1 antikoerper, ccn1 antikoerper, cna1 antikoerper, ppp2b antikoerper, fj46e08 antikoerper, si:dkeyp-79c2.2 antikoerper, wu:fj46e08 antikoerper, ppp3ca antikoerper, protein phosphatase 3 catalytic subunit alpha antikoerper, protein phosphatase 3, catalytic subunit, alpha isoform antikoerper, protein phosphatase 3, catalytic subunit, alpha isozyme antikoerper, protein phosphatase 3 (formerly 2B), catalytic subunit, alpha isoform (calcineurin A alpha) antikoerper, protein phosphatase 3, catalytic subunit, alpha isozyme L homeolog antikoerper, serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform antikoerper, PPP3CA antikoerper, Ppp3ca antikoerper, ppp3ca antikoerper, ppp3ca.L antikoerper, LOC100205420 antikoerper

Hintergrund: PPP3CA belongs to the PPP phosphatase family, PP-2B subfamily. It is a calcium-dependent, calmodulin-stimulated protein phosphatase. This subunit may have a role in the calmodulin activation of calcineurin. PPP3CA dephosphorylates HSPB1 and SSH1.

Molekulargewicht: 59 kDa (MW of target protein)

Pathways: RTK Signalweg, WNT Signalweg, Fc-epsilon Rezeptor Signalübertragung, Negative Regulation of Hormone Secretion, Carbohydrate Homeostasis, Synaptic Membrane, Skeletal Muscle Fiber Development, Protein targeting to Nucleus, VEGF Signaling, BCR Signaling