Amyloid beta (A4) Precursor Protein-Binding, Family B, Member 1 Interacting Protein (APBB1IP) (N-Term) Antikörper

Produktnummer ABIN632668

Produktdetails

Target: Amyloid beta (A4) Precursor Protein-Binding, Family B, Member 1 Interacting Protein (APBB1IP)

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: APBB1 IP antibody was raised against the N terminal Of Apbb1 p

Aufreinigung: Affinity purified

Immunogen: APBB1 IP antibody was raised using the N terminal Of Apbb1 p corresponding to a region with amino acids LVADISEAEQRTIQAQKESLQNQHHSASLQASIFSGAASLGYGTNVAATG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

APBB1IP Blocking Peptide, catalog no. 33R-5496, is also available for use as a blocking control in assays to test for specificity of this APBB1IP antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of APBB0 P antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Antigendetails

Target: Amyloid beta (A4) Precursor Protein-Binding, Family B, Member 1 Interacting Protein (APBB1IP)

Andere Bezeichnung: APBB1IP (APBB1IP Produkte)

Synonyme: zgc:63968 antikoerper, apbb1ip antikoerper, MGC80693 antikoerper, APBB1IP antikoerper, INAG1 antikoerper, PREL1 antikoerper, RARP1 antikoerper, RIAM antikoerper, 9930118P07Rik antikoerper, Prp48 antikoerper, amyloid beta (A4) precursor protein-binding, family B, member 1 interacting protein antikoerper, amyloid beta (A4) precursor protein-binding, family B, member 1 interacting protein S homeolog antikoerper, amyloid beta precursor protein binding family B member 1 interacting protein antikoerper, amyloid beta A4 precursor protein-binding family B member 1-interacting protein antikoerper, apbb1ip antikoerper, apbb1ip.S antikoerper, APBB1IP antikoerper, LOC707383 antikoerper, LOC100439620 antikoerper, LOC100598478 antikoerper, Apbb1ip antikoerper

Hintergrund: APBB1IP appears to function in the signal transduction from Ras activation to actin cytoskeletal remodeling. APBB1IP suppresses insulin-induced promoter activities through AP1 and SRE. APBB1IP mediates Rap1-induced adhesion.

Molekulargewicht: 73 kDa (MW of target protein)