BDH2 Antikörper (Middle Region)
-
- Target Alle BDH2 Antikörper anzeigen
- BDH2 (3-hydroxybutyrate Dehydrogenase, Type 2 (BDH2))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser BDH2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- BDH2 antibody was raised against the middle region of BDH2
- Aufreinigung
- Affinity purified
- Immunogen
- BDH2 antibody was raised using the middle region of BDH2 corresponding to a region with amino acids NRCVYSTTKAAVIGLTKSVAADFIQQGIRCNCVCPGTVDTPSLQERIQAR
- Top Product
- Discover our top product BDH2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
BDH2 Blocking Peptide, catalog no. 33R-6852, is also available for use as a blocking control in assays to test for specificity of this BDH2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BDH2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- BDH2 (3-hydroxybutyrate Dehydrogenase, Type 2 (BDH2))
- Andere Bezeichnung
- BDH2 (BDH2 Produkte)
- Synonyme
- DHRS6 antikoerper, BDH2 antikoerper, bdh2 antikoerper, EFA6R antikoerper, PRO20933 antikoerper, SDR15C1 antikoerper, UCPA-OR antikoerper, UNQ6308 antikoerper, 1810026B04Rik antikoerper, Dhrs6 antikoerper, zgc:110323 antikoerper, 3-hydroxybutyrate dehydrogenase, type 2 antikoerper, 3-hydroxybutyrate dehydrogenase 2 antikoerper, 3-hydroxybutyrate dehydrogenase 2 L homeolog antikoerper, BDH2 antikoerper, bdh2 antikoerper, Bdh2 antikoerper, bdh2.L antikoerper
- Hintergrund
- BDH2 is a dehydrogenase that mediates the formation of 2,5-dihydroxybenzoic acid (2,5-DHBA), a siderophore that shares structural similarities with bacterial enterobactin and associates with LCN2, thereby playing a key role in iron homeostasis and transport. It also acts as a 3-hydroxybutyrate dehydrogenase.
- Molekulargewicht
- 27 kDa (MW of target protein)
- Pathways
- Transition Metal Ion Homeostasis, Monocarboxylic Acid Catabolic Process
-