C1orf131 Antikörper (Middle Region)
-
- Target Alle C1orf131 Produkte
- C1orf131 (Chromosome 1 Open Reading Frame 131 (C1orf131))
-
Bindungsspezifität
- Middle Region
- Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser C1orf131 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- C1 ORF131 antibody was raised against the middle region of C1 rf131
- Aufreinigung
- Affinity purified
- Immunogen
- C1 ORF131 antibody was raised using the middle region of C1 rf131 corresponding to a region with amino acids TGPEILAAAVPPSSLKNNREQVEVVEFHSNKKRKLTPDHNKNTKQANPSV
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
C1ORF131 Blocking Peptide, catalog no. 33R-9091, is also available for use as a blocking control in assays to test for specificity of this C1ORF131 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF131 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- C1orf131 (Chromosome 1 Open Reading Frame 131 (C1orf131))
- Andere Bezeichnung
- C1ORF131 (C1orf131 Produkte)
- Synonyme
- C3H1orf131 antikoerper, 3110004G14Rik antikoerper, Ayu21-55 antikoerper, Gt(pU21)55Imeg antikoerper, GtAyu21-55 antikoerper, chromosome 1 open reading frame 131 antikoerper, chromosome 3 open reading frame, human C1orf131 antikoerper, RIKEN cDNA 2810004N23 gene antikoerper, similar to RIKEN cDNA 0610039J04 antikoerper, C1orf131 antikoerper, C3H1ORF131 antikoerper, c1orf131 antikoerper, 2810004N23Rik antikoerper, RGD1562218 antikoerper
- Hintergrund
- The function of Chromosome 1 ORF protein is not widely studied, and is yet to be elucidated fully.
- Molekulargewicht
- 32 kDa (MW of target protein)
-