CAMK1G Antikörper (N-Term)
-
- Target Alle CAMK1G Antikörper anzeigen
- CAMK1G (Calcium/calmodulin-Dependent Protein Kinase IG (CAMK1G))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CAMK1G Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- CAMK1 G antibody was raised against the N terminal of CAMK1
- Aufreinigung
- Affinity purified
- Immunogen
- CAMK1 G antibody was raised using the N terminal of CAMK1 corresponding to a region with amino acids SEVFLVKQRLTGKLFALKCIKKSPAFRDSSLENEIAVLKKIKHENIVTLE
- Top Product
- Discover our top product CAMK1G Primärantikörper
-
anti-Calcium/calmodulin-Dependent Protein Kinase IG (CAMK1G) (AA 420-450), (C-Term) antibody
CAMK1G Reaktivität: Human WB, IHC (p) Wirt: Kaninchen Polyclonal RB1249 unconjugated
anti-Calcium/calmodulin-Dependent Protein Kinase IG (CAMK1G) (AA 217-476) antibodyCAMK1G Reaktivität: Human WB, ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Calcium/calmodulin-Dependent Protein Kinase IG (CAMK1G) (AA 211-241) antibodyCAMK1G Reaktivität: Human WB, IHC (p) Wirt: Kaninchen Polyclonal RB15447 unconjugated
anti-Calcium/calmodulin-Dependent Protein Kinase IG (CAMK1G) (AA 1-476) antibodyCAMK1G Reaktivität: Human WB, ELISA Wirt: Maus Monoclonal 3E2 unconjugated
anti-Calcium/calmodulin-Dependent Protein Kinase IG (CAMK1G) (AA 1-476) antibodyCAMK1G Reaktivität: Human WB Wirt: Maus Polyclonal unconjugated
anti-Calcium/calmodulin-Dependent Protein Kinase IG (CAMK1G) (C-Term) antibodyCAMK1G Reaktivität: Human WB, IHC (p), EIA Wirt: Kaninchen Polyclonal unconjugated
anti-Calcium/calmodulin-Dependent Protein Kinase IG (CAMK1G) antibodyCAMK1G Reaktivität: Human WB Wirt: Kaninchen Polyclonal unconjugated
anti-Calcium/calmodulin-Dependent Protein Kinase IG (CAMK1G) (AA 35-84) antibodyCAMK1G Reaktivität: Human, Maus, Ratte, Hund, Meerschweinchen, Pferd, Kaninchen, Rind (Kuh), Affe, Fledermaus, Schwein WB Wirt: Kaninchen Polyclonal unconjugated
anti-Calcium/calmodulin-Dependent Protein Kinase IG (CAMK1G) (AA 251-300) antibodyCAMK1G Reaktivität: Human, Maus, Ratte, Hund, Meerschweinchen, Pferd, Kaninchen, Affe WB Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
CAMK1G Blocking Peptide, catalog no. 33R-8410, is also available for use as a blocking control in assays to test for specificity of this CAMK1G antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CAMK0 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CAMK1G (Calcium/calmodulin-Dependent Protein Kinase IG (CAMK1G))
- Andere Bezeichnung
- CAMK1G (CAMK1G Produkte)
- Synonyme
- camk1g antikoerper, wu:fk53c02 antikoerper, zgc:73127 antikoerper, CAMK1G antikoerper, Ci-CaM-K antikoerper, wu:fk61c03 antikoerper, zgc:73155 antikoerper, CLICK-III antikoerper, CaMKIgamma antikoerper, CLICK3 antikoerper, CLICKIII antikoerper, VWS1 antikoerper, dJ272L16.1 antikoerper, calcium/calmodulin-dependent protein kinase IGa antikoerper, calcium/calmodulin-dependent protein kinase IG antikoerper, calmodulin-dependent protein kinase homologue antikoerper, calcium/calmodulin dependent protein kinase IG antikoerper, calcium/calmodulin-dependent protein kinase IGb antikoerper, calcium/calmodulin-dependent protein kinase I gamma antikoerper, camk1ga antikoerper, CAMK1G antikoerper, cam-k antikoerper, camk1gb antikoerper, Camk1g antikoerper
- Hintergrund
- This gene encodes a protein similar to calcium/calmodulin dependent protein kinase, however, its exact function is not known.
- Molekulargewicht
- 53 kDa (MW of target protein)
-
