OSBPL1A Antikörper (Middle Region)

Produktnummer ABIN632643

Produktdetails anti-OSBPL1A Antikörper

Target: OSBPL1A (Oxysterol Binding Protein-Like 1A (OSBPL1A))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser OSBPL1A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: OSBPL1 A antibody was raised against the middle region of OSBPL1

Aufreinigung: Affinity purified

Immunogen: OSBPL1 A antibody was raised using the middle region of OSBPL1 corresponding to a region with amino acids EGEHLGSRKHRMSEEKDCGGGDALSNGIKKHRTSLPSPMFSRNDFSIWSI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

OSBPL1A Blocking Peptide, catalog no. 33R-2425, is also available for use as a blocking control in assays to test for specificity of this OSBPL1A antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OSBPL0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu OSBPL1A

Target: OSBPL1A (Oxysterol Binding Protein-Like 1A (OSBPL1A))

Andere Bezeichnung: OSBPL1A (OSBPL1A Produkte)

Synonyme: ORP-1 antikoerper, ORP1 antikoerper, OSBPL1B antikoerper, G430090F17Rik antikoerper, Gm753 antikoerper, Osbpl1b antikoerper, si:dkey-121a11.8 antikoerper, DKFZp459N1538 antikoerper, oxysterol binding protein like 1A antikoerper, oxysterol binding protein-like 1A antikoerper, oxysterol-binding protein-related protein 1 antikoerper, oxysterol binding protein like 1A L homeolog antikoerper, OSBPL1A antikoerper, Osbpl1a antikoerper, osbpl1a antikoerper, Tsp_09273 antikoerper, Tsp_03387 antikoerper, osbpl1a.L antikoerper

Hintergrund: This gene encodes a member of the oxysterol-binding protein (OSBP) family, a group of intracellular lipid receptors. Most members contain an N-terminal pleckstrin homology domain and a highly conserved C-terminal OSBP-like sterol-binding domain, although some members contain only the sterol-binding domain. Transcript variants derived from alternative promoter usage and/or alternative splicing exist, they encode different isoforms.

Molekulargewicht: 108 kDa (MW of target protein)