RAP1 Antikörper (Middle Region)
-
- Target Alle RAP1 (TERF2IP) Antikörper anzeigen
- RAP1 (TERF2IP) (Telomeric Repeat Binding Factor 2, Interacting Protein (TERF2IP))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser RAP1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- TERF2 IP antibody was raised against the middle region of TERF2 P
- Aufreinigung
- Affinity purified
- Immunogen
- TERF2 IP antibody was raised using the middle region of TERF2 P corresponding to a region with amino acids EDPEAADSGEPQNKRTPDLPEEEYVKEEIQENEEAVKKMLVEATREFEEV
- Top Product
- Discover our top product TERF2IP Primärantikörper
-
anti-Telomeric Repeat Binding Factor 2, Interacting Protein (TERF2IP) antibody
TERF2IP Reaktivität: Human, Maus, Ratte WB, IHC, IF Wirt: Kaninchen Polyclonal unconjugated
anti-Telomeric Repeat Binding Factor 2, Interacting Protein (TERF2IP) (Center) antibodyTERF2IP Reaktivität: Human, Maus WB, IF, IP, IHC (p), ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Telomeric Repeat Binding Factor 2, Interacting Protein (TERF2IP) (AA 1-184) antibodyTERF2IP Reaktivität: Human, Maus, Ratte, Huhn, Frosch WB, IF, IP, IHC (f) Wirt: Maus Monoclonal 3-Rap1 unconjugated
anti-Telomeric Repeat Binding Factor 2, Interacting Protein (TERF2IP) (AA 1-280) antibodyTERF2IP Reaktivität: Human ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Telomeric Repeat Binding Factor 2, Interacting Protein (TERF2IP) (AA 1-399) antibodyTERF2IP Reaktivität: Human WB, IHC (p) Wirt: Maus Monoclonal 1664CT768-14-43 unconjugated
anti-Telomeric Repeat Binding Factor 2, Interacting Protein (TERF2IP) (AA 349-378), (C-Term) antibodyTERF2IP Reaktivität: Human WB, IHC (p) Wirt: Kaninchen Polyclonal RB34101 unconjugated
anti-Telomeric Repeat Binding Factor 2, Interacting Protein (TERF2IP) (AA 1-280) antibodyTERF2IP Reaktivität: Human WB, IF Wirt: Kaninchen Polyclonal unconjugated
anti-Telomeric Repeat Binding Factor 2, Interacting Protein (TERF2IP) (AA 1-280) antibodyTERF2IP Reaktivität: Human WB, IF Wirt: Kaninchen Polyclonal unconjugated
anti-Telomeric Repeat Binding Factor 2, Interacting Protein (TERF2IP) (AA 142-191) antibodyTERF2IP Reaktivität: Human, Maus, Ratte, Hund, Meerschweinchen, Affe, Kaninchen, Hamster, Fledermaus WB, IHC, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-Telomeric Repeat Binding Factor 2, Interacting Protein (TERF2IP) (AA 1-184) antibodyTERF2IP Reaktivität: Human, Maus, Ratte, Huhn, Frosch WB, IF, IP, IHC (f) Wirt: Maus Monoclonal 3-Rap1 unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
TERF2IP Blocking Peptide, catalog no. 33R-2322, is also available for use as a blocking control in assays to test for specificity of this TERF2IP antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TERF0 P antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RAP1 (TERF2IP) (Telomeric Repeat Binding Factor 2, Interacting Protein (TERF2IP))
- Andere Bezeichnung
- TERF2IP (TERF2IP Produkte)
- Synonyme
- DRIP5 antikoerper, RAP1 antikoerper, Rap1 antikoerper, cRAP1 antikoerper, TERF2 interacting protein antikoerper, telomeric repeat binding factor 2, interacting protein antikoerper, TERF2IP antikoerper, Terf2ip antikoerper
- Hintergrund
- The gene encodes a protein that is part of a complex involved in telomere length regulation. Pseudogenes are present on chromosomes 5 and 22.
- Molekulargewicht
- 44 kDa (MW of target protein)
- Pathways
- Zellzyklus, Telomere Maintenance
-
