RALB Antikörper
-
- Target Alle RALB (Ralb) Antikörper anzeigen
- RALB (Ralb) (V-Ral Simian Leukemia Viral Oncogene Homolog B (Ras Related, GTP Binding Protein) (Ralb))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser RALB Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- RALB antibody was raised using a synthetic peptide corresponding to a region with amino acids FREQILRVKAEEDKIPLLVVGNKSDLEERRQVPVEEARSKAEEWGVQYVE
- Top Product
- Discover our top product Ralb Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
RALB Blocking Peptide, catalog no. 33R-3044, is also available for use as a blocking control in assays to test for specificity of this RALB antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RALB antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RALB (Ralb) (V-Ral Simian Leukemia Viral Oncogene Homolog B (Ras Related, GTP Binding Protein) (Ralb))
- Andere Bezeichnung
- RALB (Ralb Produkte)
- Synonyme
- dRalb antikoerper, 5730472O18Rik antikoerper, Ral B antikoerper, ralb antikoerper, xralb antikoerper, zgc:100801 antikoerper, KRAS2 antikoerper, k-ras antikoerper, RAS like proto-oncogene B antikoerper, v-ral simian leukemia viral oncogene B antikoerper, v-ral simian leukemia viral oncogene homolog B L homeolog antikoerper, v-ral simian leukemia viral oncogene homolog Ba (ras related) antikoerper, v-ral simian leukemia viral oncogene homolog B (ras related; GTP binding protein) antikoerper, RALB antikoerper, Ralb antikoerper, ralb.L antikoerper, ralba antikoerper, ralb antikoerper
- Hintergrund
- This gene encodes a GTP-binding protein that belongs to the small GTPase superfamily and Ras family of proteins. GTP-binding proteins mediate the transmembrane signaling initiated by the occupancy of certain cell surface receptors.
- Molekulargewicht
- 23 kDa (MW of target protein)
- Pathways
- Neurotrophin Signalübertragung, CXCR4-mediated Signaling Events
-